Hyposensitisation to wasp venom in six hours.

نویسندگان
چکیده

برای دانلود باید عضویت طلایی داشته باشید

برای دانلود متن کامل این مقاله و بیش از 32 میلیون مقاله دیگر ابتدا ثبت نام کنید

اگر عضو سایت هستید لطفا وارد حساب کاربری خود شوید

منابع مشابه

Hyposensitisation to wasp venom in six hours.

Eleven patients with a history of anaphylaxis, positive reactions to skin tests, and specific IgE antibody to wasp venom underwent hyposensitisation in a six hour procedure. No general reactions occurred. Complement activation and proteinuria could not be shown. The patterns of specific IgE, IgG1, and IgG4 were as described in other procedures--namely, IgE increased sharply and then decreased; ...

متن کامل

Wasp venom allergy: effect of anti-IgE antibody on wasp venom anaphylaxis in a mouse model.

BACKGROUND Although anti-IgE antibody (Ab) therapy was recently shown to be effective in patients with bronchial asthma, no study has reported the effect of IgE therapy in the prevention of wasp venom anaphylaxis. In this study, we used a mouse model of wasp venom allergy to investigate the effect of anti-IgE Ab on wasp venom anaphylaxis. METHODS We developed a mouse model of wasp venom aller...

متن کامل

Successful venom immunotherapy to paper wasp, in IgE-venom negative patient.

3. Maibach H.J., Johnson H.L. Contact urticaria syndrome. Contact urticaria to diethyltoluamide. Arch Dermatol 1975;111:726-730. 4. Miller JD. Anaphylaxis associated with insect repellent. N Engl J Med. 1982;307(21):1341—2. 5. Von Mayenburg J, Rakoski J. Contact urticaria to diethyltoluamide. Contact Dermatitis. 1983;9(2):171. 6. Vozmediano JM, Armario J, Gonzalez-Cabrerizo A. Immunologic conta...

متن کامل

Pharmacological and Immunological Properties of Wasp Venom

Animal toxin envenomations have medical as well as ecological significance. Toxin-producing animals are categorized under either venomous group or poisonous group. Venomous animals are capable of producing and delivering the toxin during a biting or stinging act whereas poisonous animals are those whose tissues, either in whole or in part, are toxic. [1] About 75% of the world’s animal species ...

متن کامل

A novel bioactive peptide from wasp venom

Wasp venoms contain a number of pharmacologically active biomolecules, undertaking a wide range of functions necessary for the wasp's survival. We purified and characterized a novel bioactive peptide (vespin) from the venoms of Vespa magnifica (Smith) wasps with unique primary structure. Its amino acid sequence was determined to be CYQRRVAITAGGLKHRLMSSLIIIIIIRINYLRDNSVIILESSY. It has 44 residue...

متن کامل

ذخیره در منابع من


  با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید

ژورنال

عنوان ژورنال: BMJ

سال: 1983

ISSN: 0959-8138,1468-5833

DOI: 10.1136/bmj.287.6402.1329